Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS17 Peptide - N-terminal region

RPS17 Peptide - N-terminal region

Product Specifications

Product Name Alternative

S17, DBA4, RPS17L, RPS17L1, RPS17L2

UniProt

P08708

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS17 Rabbit Polyclonal Antibody (orb588884) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001012.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RTKTVKKAARVIIEKYYTRLGNDFHTNKRVCEEIAIIPSKKLRNKIAGYV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ARG1/Arginase-1 Protein, C-His (Active)
AHC12601 100 μg

Recombinant Human ARG1/Arginase-1 Protein, C-His (Active)

Sign In for Pricing
View Details
JOS2 Antibody
MBS9520254-01 0.04 mL

JOS2 Antibody

Sign In for Pricing
View Details
JOS2 Antibody
MBS9520254-02 0.1 mL

JOS2 Antibody

Sign In for Pricing
View Details
JOS2 Antibody
MBS9520254-03 0.2 mL

JOS2 Antibody

Sign In for Pricing
View Details
JOS2 Antibody
MBS9520254-04 5x 0.2 mL

JOS2 Antibody

Sign In for Pricing
View Details
Smurf1 ligand 1
T200362-01 10 mg

Smurf1 ligand 1

Sign In for Pricing
View Details