SH3BGRL3 Peptide - N-terminal region
SH3BGRL3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
TIP-B1, SH3BP-1, HEL-S-297
UniProt
Q5T123
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SH3BGRL3 Rabbit Polyclonal Antibody (orb589529) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_112576.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: STSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940756-100 1x 100 µL
Neurofilament (H+L) (NF421 + NFL736), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881602-100 1x 100 µL
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details