SH3BGRL3 Peptide - N-terminal region
SH3BGRL3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
TIP-B1, SH3BP-1, HEL-S-297
UniProt
Q5T123
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SH3BGRL3 Rabbit Polyclonal Antibody (orb589529) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_112576.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: STSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-UNEL-H0274-01 5x 96 Tests
Uncoated Human CFD (Complement Factor D) ELISA Kit
Sign In for Pricing
View Details E-UNEL-H0274-02 15x 96 Tests
Uncoated Human CFD (Complement Factor D) ELISA Kit
Sign In for Pricing
View Details 
BNC400348-500 1x 500 µL
Histiocytoma Marker (D11), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471594-100 1x 100 µL
CD22 / BL-CAM (B-Cell Marker) (RFB4), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details