RFPL2 Peptide - middle region
RFPL2 Peptide - middle region
Product Specifications
Product Name Alternative
RNF79
UniProt
O75678
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RFPL2 Rabbit Polyclonal Antibody (orb588768) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001091997.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GCAVCLKCINSLQKEPHGEDLLCCCSSMVSRKNKIRRNRQLERLASHIKE
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rabbit Polyclonal Motilin Antibody [Janelia Fluor 646]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NBP2-97102JF646 0.1 mL
Rabbit Polyclonal Motilin Antibody [Janelia Fluor 646]
Sign In for Pricing
View Details 
M-1575-100 100 µg
Anti-Spectrin alpha chain, non-erythrocytic 1 Antibody
Sign In for Pricing
View Details NBP3-13945-20ug 20 µg
Mouse Monoclonal ZNF81 Antibody (PCRP-ZNF81-2G2)
Sign In for Pricing
View Details