YIF1A Peptide - N-terminal region
YIF1A Peptide - N-terminal region
Product Specifications
Product Name Alternative
54TM, YIF1, YIF1P, FinGER7
UniProt
O95070
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with YIF1A Rabbit Polyclonal Antibody (orb588392) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_065203.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: APDPPPLFDDTSGGYSSQPGGYPATGADVAFSVNHLLGDPMANVAMAYGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC431170 20 µg
ST6GALNAC3 (NM_001160011) Human Over-expression Lysate
Sign In for Pricing
View Details 
