Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRAK3 Peptide - middle region

IRAK3 Peptide - middle region

Product Specifications

Product Name Alternative

ASRT5, IRAKM

UniProt

Q9Y616

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IRAK3 Rabbit Polyclonal Antibody (orb589739) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001135995.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDDESQNNNLLPSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKPESKRNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpp21 (NM_001002831) Rat Tagged ORF Clone Lentiviral Particle
RR200690L4V 200 µL

Rpp21 (NM_001002831) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Prolyl 3-Hydroxylase 3 (P3H3) Antibody
abx213337-01 50 µL

Prolyl 3-Hydroxylase 3 (P3H3) Antibody

Sign In for Pricing
View Details
Prolyl 3-Hydroxylase 3 (P3H3) Antibody
abx213337-02 100 µL

Prolyl 3-Hydroxylase 3 (P3H3) Antibody

Sign In for Pricing
View Details
FERMT1 Human Pre-designed siRNA Set A
HY-RS04864 1 Set

FERMT1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Pak3 (NM_001195048) Mouse Tagged Lenti ORF Clone
MR225427L3 10 µg

Pak3 (NM_001195048) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal MYD118 Antibody [Janelia Fluor 549]
NBP3-06405JF549 0.1 mL

Rabbit Polyclonal MYD118 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details