IRAK3 Peptide - middle region
IRAK3 Peptide - middle region
Product Specifications
Product Name Alternative
ASRT5, IRAKM
UniProt
Q9Y616
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IRAK3 Rabbit Polyclonal Antibody (orb589739) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001135995.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EDDESQNNNLLPSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKPESKRNE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2036287-01 0.1 mL
HRP-Linked Monoclonal Antibody to Interleukin 10 (IL10)
Sign In for Pricing
View Details MBS2036287-02 0.2 mL
HRP-Linked Monoclonal Antibody to Interleukin 10 (IL10)
Sign In for Pricing
View Details MBS2036287-03 0.5 mL
HRP-Linked Monoclonal Antibody to Interleukin 10 (IL10)
Sign In for Pricing
View Details MBS2036287-04 1 mL
HRP-Linked Monoclonal Antibody to Interleukin 10 (IL10)
Sign In for Pricing
View Details MBS2036287-05 5 mL
HRP-Linked Monoclonal Antibody to Interleukin 10 (IL10)
Sign In for Pricing
View Details MBS2036287-06 5x 5 mL
HRP-Linked Monoclonal Antibody to Interleukin 10 (IL10)
Sign In for Pricing
View Details