Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRAK3 Peptide - middle region

IRAK3 Peptide - middle region

Product Specifications

Product Name Alternative

ASRT5, IRAKM

UniProt

Q9Y616

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IRAK3 Rabbit Polyclonal Antibody (orb589739) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001135995.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDDESQNNNLLPSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKPESKRNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP-Linked Monoclonal Antibody to Interleukin 10 (IL10)
MBS2036287-01 0.1 mL

HRP-Linked Monoclonal Antibody to Interleukin 10 (IL10)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Interleukin 10 (IL10)
MBS2036287-02 0.2 mL

HRP-Linked Monoclonal Antibody to Interleukin 10 (IL10)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Interleukin 10 (IL10)
MBS2036287-03 0.5 mL

HRP-Linked Monoclonal Antibody to Interleukin 10 (IL10)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Interleukin 10 (IL10)
MBS2036287-04 1 mL

HRP-Linked Monoclonal Antibody to Interleukin 10 (IL10)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Interleukin 10 (IL10)
MBS2036287-05 5 mL

HRP-Linked Monoclonal Antibody to Interleukin 10 (IL10)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Interleukin 10 (IL10)
MBS2036287-06 5x 5 mL

HRP-Linked Monoclonal Antibody to Interleukin 10 (IL10)

Sign In for Pricing
View Details