Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SORBS1 Peptide - middle region

SORBS1 Peptide - middle region

Product Specifications

Product Name Alternative

CAP, FLAF2, R85FL, SH3D5, SORB1, SH3P12

UniProt

Q9BX66

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SORBS1 Rabbit Polyclonal Antibody (orb586141) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

AAH42612

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SERRVGEQDSAPTQEKPTSPGKAIEKRAKDDSRRVVKSTQDLSDVSMDEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5β-PREGNAN-3α, 17, 20β, 21-TETROL 3, 20-DIACETATE
504269 Inquire

5β-PREGNAN-3α, 17, 20β, 21-TETROL 3, 20-DIACETATE

Sign In for Pricing
View Details
Human IL32 (NM_001012635) AAV Particle
RC222815A1V 250 µL

Human IL32 (NM_001012635) AAV Particle

Sign In for Pricing
View Details
PRR15 Human shRNA Plasmid Kit (Locus ID 222171)
TR318944 1 Kit

PRR15 Human shRNA Plasmid Kit (Locus ID 222171)

Sign In for Pricing
View Details
Mouse Monoclonal Phosphopantothenate-cysteine ligase Antibody (10D11) [Alexa Fluor 594]
NBP2-59481AF594 0.1 mL

Mouse Monoclonal Phosphopantothenate-cysteine ligase Antibody (10D11) [Alexa Fluor 594]

Sign In for Pricing
View Details
PGDH Rabbit Polyclonal Antibody
JOT-AP11898-01 20 µL

PGDH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PGDH Rabbit Polyclonal Antibody
JOT-AP11898-02 50 μL

PGDH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details