CEP89 Peptide - middle region
CEP89 Peptide - middle region
Product Specifications
Product Name Alternative
CEP123, CCDC123
UniProt
K7EQI2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CEP89 Rabbit Polyclonal Antibody (orb589414) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_116205.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HRNQVPLLHEVNSEDDENISHQDGFPGSPPAPQRTQQKDGKHPVLNLKDE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC224693L3V 200 µL
TORC1 (CRTC1) (NM_001098482) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
MBS1158251-01 0.02 mg (E-Coli)
Recombinant Ictalurus punctatus Prolactin (prl)
Sign In for Pricing
View Details