Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP89 Peptide - middle region

CEP89 Peptide - middle region

Product Specifications

Product Name Alternative

CEP123, CCDC123

UniProt

K7EQI2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEP89 Rabbit Polyclonal Antibody (orb589414) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_116205.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HRNQVPLLHEVNSEDDENISHQDGFPGSPPAPQRTQQKDGKHPVLNLKDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6-Ido1 Plasmid
PVT58012 2 µg

pCMV-SPORT6-Ido1 Plasmid

Sign In for Pricing
View Details
Abhd14a Rat siRNA Oligo Duplex (Locus ID 300982)
SR503159 1 Kit

Abhd14a Rat siRNA Oligo Duplex (Locus ID 300982)

Sign In for Pricing
View Details
GAPDHP28 ORF Vector (Human) (pORF)
ORF020012 1.0 µg DNA

GAPDHP28 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
1,7-Dihydroxy-2,3-methylenedioxyxanthone
AB1834 5 mg

1,7-Dihydroxy-2,3-methylenedioxyxanthone

Sign In for Pricing
View Details
Rabbit Polyclonal G protein alpha-13 Antibody
NBP3-37921-100ul 100 µL

Rabbit Polyclonal G protein alpha-13 Antibody

Sign In for Pricing
View Details
CYPOR Protein, Mouse, Recombinant (His)
TMPH-02801-01 5 µg

CYPOR Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details