Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMD Peptide - C-terminal region

DMD Peptide - C-terminal region

Product Specifications

Product Name Alternative

BMD, CMD3B, MRX85, DXS142, DXS164, DXS206, DXS230, DXS239, DXS268, DXS269, DXS270, DXS272

UniProt

P11532

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMD Rabbit Polyclonal Antibody (orb589355) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000100.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQTSDSMGEEDLLSPPQDTSTGLEEVMEQLNNSFPSSRGRNTPGKPMRED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 Antibody
orb635720 100 µL

CD7 Antibody

Sign In for Pricing
View Details
HLA-B Antibody, HRP conjugated
A77428-100UL 100 µL

HLA-B Antibody, HRP conjugated

Sign In for Pricing
View Details
Ethyl 2-Propyl-4-pentenoate
164078 250 mg

Ethyl 2-Propyl-4-pentenoate

Sign In for Pricing
View Details
Cytokeratin, Pan (AP) discontinued
C9097-48D-AP 100 µL

Cytokeratin, Pan (AP) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal BRCA1 [p Ser1466] Antibody [DyLight 350]
NB100-228UV 0.1 mL

Rabbit Polyclonal BRCA1 [p Ser1466] Antibody [DyLight 350]

Sign In for Pricing
View Details
TRUB1 siRNA (m)
sc-154699 10 µM

TRUB1 siRNA (m)

Sign In for Pricing
View Details