Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMD Peptide - C-terminal region

DMD Peptide - C-terminal region

Product Specifications

Product Name Alternative

BMD, CMD3B, MRX85, DXS142, DXS164, DXS206, DXS230, DXS239, DXS268, DXS269, DXS270, DXS272

UniProt

P11532

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMD Rabbit Polyclonal Antibody (orb589355) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000100.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQTSDSMGEEDLLSPPQDTSTGLEEVMEQLNNSFPSSRGRNTPGKPMRED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3KBP1 (NM_031892) Human Tagged ORF Clone Lentiviral Particle
RC202186L3V 200 µL

SH3KBP1 (NM_031892) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PNPLA3 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-24045R-BF680 100 µL

PNPLA3 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
TMEM74 Protein Vector (Human) (pPB-N-His)
PV043010 500 ng

TMEM74 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit Polyclonal PGAM1 Antibody [Janelia Fluor 549]
NBP1-49532JF549 0.1 mL

Rabbit Polyclonal PGAM1 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Human Nei Endonuclease VIII Like Protein 1 (NEIL1) ELISA Kit
RD-NEIL1-Hu-01 96 Tests

Human Nei Endonuclease VIII Like Protein 1 (NEIL1) ELISA Kit

Sign In for Pricing
View Details
Human Nei Endonuclease VIII Like Protein 1 (NEIL1) ELISA Kit
RD-NEIL1-Hu-02 48 Tests

Human Nei Endonuclease VIII Like Protein 1 (NEIL1) ELISA Kit

Sign In for Pricing
View Details