Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE2A Peptide - middle region

PDE2A Peptide - middle region

Product Specifications

Product Name Alternative

PDE2A1, PED2A4, cGSPDE, CGS-PDE

UniProt

O00408

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDE2A Rabbit Polyclonal Antibody (orb589715) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001137311.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEGTAEDQKGGAAYTDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL4 Peptide
AF5142-BP 1 mg

IL4 Peptide

Sign In for Pricing
View Details
Sheep IgG F (ab') 2 Antibody Alkaline Phosphatase Conjugated Pre-Adsorbed
orb347935 500 µg

Sheep IgG F (ab') 2 Antibody Alkaline Phosphatase Conjugated Pre-Adsorbed

Sign In for Pricing
View Details
1- (4-Chloro-3-Trifluoromethylphenyl) Piperazine
FC89730-01 500 mg

1- (4-Chloro-3-Trifluoromethylphenyl) Piperazine

Sign In for Pricing
View Details
1- (4-Chloro-3-Trifluoromethylphenyl) Piperazine
FC89730-02 1000 mg

1- (4-Chloro-3-Trifluoromethylphenyl) Piperazine

Sign In for Pricing
View Details
1- (4-Chloro-3-Trifluoromethylphenyl) Piperazine
FC89730-03 2000 mg

1- (4-Chloro-3-Trifluoromethylphenyl) Piperazine

Sign In for Pricing
View Details
1- (4-Chloro-3-Trifluoromethylphenyl) Piperazine
FC89730-04 5000 mg

1- (4-Chloro-3-Trifluoromethylphenyl) Piperazine

Sign In for Pricing
View Details