Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE2A Peptide - middle region

PDE2A Peptide - middle region

Product Specifications

Product Name Alternative

PDE2A1, PED2A4, cGSPDE, CGS-PDE

UniProt

O00408

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDE2A Rabbit Polyclonal Antibody (orb589715) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001137311.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEGTAEDQKGGAAYTDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAS1L (LAS1-like (S. cerevisiae), FLJ12525, dJ475B7.2)
248068 50 µL

LAS1L (LAS1-like (S. cerevisiae), FLJ12525, dJ475B7.2)

Sign In for Pricing
View Details
INPP1 Human Over-expression Lysate
orb1344896 100 µg

INPP1 Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral mouse Malt1 shRNA (UAS) - Lentiviral mouse Malt1 shRNA (UAS, RFP) (25)
GTR15170771 1 Vial

Lentiviral mouse Malt1 shRNA (UAS) - Lentiviral mouse Malt1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
ELISA kit for Rat Tn-I (Troponin I)
E-EL-R0055 96 Tests

ELISA kit for Rat Tn-I (Troponin I)

Sign In for Pricing
View Details
Lentiviral mouse 2510039O18Rik shRNA (UAS) - Lentiviral mouse 2510039O18Rik shRNA (UAS, iRFP) (100)
GTR15215775 1 Vial

Lentiviral mouse 2510039O18Rik shRNA (UAS) - Lentiviral mouse 2510039O18Rik shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
RNPK antibody (Ser284)
70R-35183 0.1 mg

RNPK antibody (Ser284)

Sign In for Pricing
View Details