Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYL12A Peptide - N-terminal region

MYL12A Peptide - N-terminal region

Product Specifications

Product Name Alternative

MLCB, MRCL3, MRLC3, MYL2B, MLC-2B, HEL-S-24

UniProt

P19105

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYL12A Rabbit Polyclonal Antibody (orb55772) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001289976.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MICB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C8]
TA813587BM 100 µL

MICB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C8]

Sign In for Pricing
View Details
MSH2 (DNA Mismatch Repair Marker) (MSH2/2622), CF568 conjugate, 0.1mg/mL
BNC682622-100 1x 100 µL

MSH2 (DNA Mismatch Repair Marker) (MSH2/2622), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ITGA5 Antibody
KC-25806-01 50 μL

ITGA5 Antibody

Sign In for Pricing
View Details
ITGA5 Antibody
KC-25806-02 100 µL

ITGA5 Antibody

Sign In for Pricing
View Details
ITGA5 Antibody
KC-25806-03 1 mL

ITGA5 Antibody

Sign In for Pricing
View Details
Citric Acid Monohydrate
TRC-C521058-10G 10 g

Citric Acid Monohydrate

Sign In for Pricing
View Details