Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYL12A Peptide - N-terminal region

MYL12A Peptide - N-terminal region

Product Specifications

Product Name Alternative

MLCB, MRCL3, MRLC3, MYL2B, MLC-2B, HEL-S-24

UniProt

P19105

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYL12A Rabbit Polyclonal Antibody (orb55772) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001289976.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Liver
CS710129 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
BCKDHB (NM_000056) Human Over-expression Lysate
LY400014 100 µg

BCKDHB (NM_000056) Human Over-expression Lysate

Sign In for Pricing
View Details
TIMP1 (Colorectal and Lymph Node Metastasis Marker) (TIMP1/1944R), CF488A conjugate, 0.1mg/mL
BNC881944-500 1x 500 µL

TIMP1 (Colorectal and Lymph Node Metastasis Marker) (TIMP1/1944R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KCNE1 (NM_001127668) Human Over-expression Lysate
LC426845 20 µg

KCNE1 (NM_001127668) Human Over-expression Lysate

Sign In for Pricing
View Details
KLHL2 (NM_007246) Human Over-expression Lysate
LY402119 100 µg

KLHL2 (NM_007246) Human Over-expression Lysate

Sign In for Pricing
View Details
Grik5 Mouse Monoclonal Antibody [Clone ID: N279B/27]
75-362 100 µL

Grik5 Mouse Monoclonal Antibody [Clone ID: N279B/27]

Sign In for Pricing
View Details