Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKG1 Peptide - C-terminal region

PRKG1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PKG, cGK, AAT8, cGK1, cGKI, cGK 1, PRKG1B, PRKGR1B, cGKI-BETA, cGKI-alpha

UniProt

Q13976

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKG1 Rabbit Polyclonal Antibody (orb589732) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001091982.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TNFRSF14 Antibody Fluoro647 Conjugated
A02298-Fluoro647 100 µg/Vial

Anti-TNFRSF14 Antibody Fluoro647 Conjugated

Sign In for Pricing
View Details
EXD2 Human Over-expression Lysate
orb1359128 20 µg

EXD2 Human Over-expression Lysate

Sign In for Pricing
View Details
GORASP2 Antibody Blocking peptide
orb1455090 500 µg

GORASP2 Antibody Blocking peptide

Sign In for Pricing
View Details
CMKLR2 (NM_001098199) Human Over-expression Lysate
LY420548 100 µg

CMKLR2 (NM_001098199) Human Over-expression Lysate

Sign In for Pricing
View Details
Guinea Pig Fibroblast Growth Factor 5 (FGF5)
MBS2615730-01 48 Well

Guinea Pig Fibroblast Growth Factor 5 (FGF5)

Sign In for Pricing
View Details
Guinea Pig Fibroblast Growth Factor 5 (FGF5)
MBS2615730-02 96 Well

Guinea Pig Fibroblast Growth Factor 5 (FGF5)

Sign In for Pricing
View Details