Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKG1 Peptide - C-terminal region

PRKG1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PKG, cGK, AAT8, cGK1, cGKI, cGK 1, PRKG1B, PRKGR1B, cGKI-BETA, cGKI-alpha

UniProt

Q13976

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKG1 Rabbit Polyclonal Antibody (orb589732) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001091982.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CD38 Antibody (003)
NBP2-89658-100ul 100 µL

Rabbit Monoclonal CD38 Antibody (003)

Sign In for Pricing
View Details
Rat Cadherin 8 (CDH8) ELISA Kit
GTR10369820 96 Well

Rat Cadherin 8 (CDH8) ELISA Kit

Sign In for Pricing
View Details
KCND3, NT (KCND3, Potassium voltage-gated channel subfamily D member 3, Voltage-gated potassium channel subunit Kv4.3) (Biotin)
MBS6312370-01 0.2 mL

KCND3, NT (KCND3, Potassium voltage-gated channel subfamily D member 3, Voltage-gated potassium channel subunit Kv4.3) (Biotin)

Sign In for Pricing
View Details
KCND3, NT (KCND3, Potassium voltage-gated channel subfamily D member 3, Voltage-gated potassium channel subunit Kv4.3) (Biotin)
MBS6312370-02 5x 0.2 mL

KCND3, NT (KCND3, Potassium voltage-gated channel subfamily D member 3, Voltage-gated potassium channel subunit Kv4.3) (Biotin)

Sign In for Pricing
View Details
Rabepk sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
38378114 3x 1.0 µg

Rabepk sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human CA4/Carbonic anhydrase 4 ELISA Kit PicoKine®, Carrier-free
EK1939-carrier-free 96 Well With Removable Strips

Human CA4/Carbonic anhydrase 4 ELISA Kit PicoKine®, Carrier-free

Sign In for Pricing
View Details