Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRB2 Peptide - middle region

GRB2 Peptide - middle region

Product Specifications

Product Name Alternative

ASH, Grb3-3, MST084, NCKAP2, MSTP084, EGFRBP-GRB2

UniProt

P62993

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRB2 Rabbit Polyclonal Antibody (orb589584) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002077.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRE11 Human Over-expression Lysate
orb1366942 20 µg

MRE11 Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:1b Probable intracellular septation protein A (YpsIP31758_1944)
MBS7041525-01 0.02 mg

Recombinant Yersinia pseudotuberculosis serotype O:1b Probable intracellular septation protein A (YpsIP31758_1944)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:1b Probable intracellular septation protein A (YpsIP31758_1944)
MBS7041525-02 0.1 mg

Recombinant Yersinia pseudotuberculosis serotype O:1b Probable intracellular septation protein A (YpsIP31758_1944)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:1b Probable intracellular septation protein A (YpsIP31758_1944)
MBS7041525-03 5x 0.1 mg

Recombinant Yersinia pseudotuberculosis serotype O:1b Probable intracellular septation protein A (YpsIP31758_1944)

Sign In for Pricing
View Details
TXN2 Peptide - middle region
orb2013188 100 µg

TXN2 Peptide - middle region

Sign In for Pricing
View Details
FCER1G Rabbit pAb, IRDye 800CW conjugated
orb2880821 100 µL

FCER1G Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details