GCFC2 Peptide - middle region
GCFC2 Peptide - middle region
Product Specifications
Product Name Alternative
GCF, TCF9, DNABF, C2orf3
UniProt
P16383
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GCFC2 Rabbit Polyclonal Antibody (orb588441) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_003194
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QKQKKVFEEVQDDFCNIQNILLKFQQWREKFPDSYYEAFISLCIPKLLNP
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV775590 1.0 µg DNA
RPL7P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details RC201087L2 10 µg
TNRC5 (CNPY3) (NM_006586) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details