Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCFC2 Peptide - middle region

GCFC2 Peptide - middle region

Product Specifications

Product Name Alternative

GCF, TCF9, DNABF, C2orf3

UniProt

P16383

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GCFC2 Rabbit Polyclonal Antibody (orb588441) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003194

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKQKKVFEEVQDDFCNIQNILLKFQQWREKFPDSYYEAFISLCIPKLLNP

More Discoveries

Explore Other Products

Browse additional items from our catalog

MraY Antibody
orb821912 2 mg

MraY Antibody

Sign In for Pricing
View Details
Rabbit Anti-NASP antibody
SL19026R-01 50 µL

Rabbit Anti-NASP antibody

Sign In for Pricing
View Details
Rabbit Anti-NASP antibody
SL19026R-02 100 µL

Rabbit Anti-NASP antibody

Sign In for Pricing
View Details
Monobutyl Phthalate
017751 1 g

Monobutyl Phthalate

Sign In for Pricing
View Details
SARS-CoV-2 Pseudoviral Particles, Brazil P1 Variant
MBS434307-01 5 mL

SARS-CoV-2 Pseudoviral Particles, Brazil P1 Variant

Sign In for Pricing
View Details
SARS-CoV-2 Pseudoviral Particles, Brazil P1 Variant
MBS434307-02 5x 5 mL

SARS-CoV-2 Pseudoviral Particles, Brazil P1 Variant

Sign In for Pricing
View Details