CCDC8 Peptide - middle region
CCDC8 Peptide - middle region
Product Specifications
Product Name Alternative
3M3, p90, PPP1R20
UniProt
Q9H0W5
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCDC8 Rabbit Polyclonal Antibody (orb589550) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_114429.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YDSSNASDSEFSDFETSRDKSRQGPRRGKKVRKMPVSYLGSKFLGSDLES
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15291282 1 Vial
Lentiviral mouse Map3k13 shRNA (UAS) - Lentiviral mouse Map3k13 shRNA (UAS) (100)
Sign In for Pricing
View Details 
249035 100 µg
MUSK (Muscle, Skeletal, Receptor Tyrosine Kinase, MGC126323, MGC126324)
Sign In for Pricing
View Details