Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AASS Peptide - middle region

AASS Peptide - middle region

Product Specifications

Product Name Alternative

LKRSDH, LORSDH, LKR/SDH

UniProt

F8WAH1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AASS Rabbit Polyclonal Antibody (orb589670) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005754.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KHPERYISRFNTDIAPYTTCLINGIYWEQNTPRLLTRQDAQSLLAPGKFS

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALPG Antibody - N-terminal region : Biotin (ARP75904_P050-Biotin)
ARP75904_P050-Biotin 100 µL

ALPG Antibody - N-terminal region : Biotin (ARP75904_P050-Biotin)

Sign In for Pricing
View Details
Heat Shock Protein 27 (HSP27) discontinued
H1830-51 500 µL

Heat Shock Protein 27 (HSP27) discontinued

Sign In for Pricing
View Details
Phospho-Tau (ser 208/210) Antibody
orb234065 50 µg

Phospho-Tau (ser 208/210) Antibody

Sign In for Pricing
View Details
RARA (Retinoic Acid Receptor alpha, RAR-alpha, Nuclear Receptor Subfamily 1 Group B Member 1, NR1B1) (MaxLight 490)
132316-ML490 100 µL

RARA (Retinoic Acid Receptor alpha, RAR-alpha, Nuclear Receptor Subfamily 1 Group B Member 1, NR1B1) (MaxLight 490)

Sign In for Pricing
View Details
LOC100040022 Adenovirus (Mouse)
26934054 1.0 mL

LOC100040022 Adenovirus (Mouse)

Sign In for Pricing
View Details
C4orf3 Antibody (FITC)
orb351791-01 50 µg

C4orf3 Antibody (FITC)

Sign In for Pricing
View Details