AASS Peptide - middle region
AASS Peptide - middle region
Product Specifications
Product Name Alternative
LKRSDH, LORSDH, LKR/SDH
UniProt
F8WAH1
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AASS Rabbit Polyclonal Antibody (orb589670) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_005754.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KHPERYISRFNTDIAPYTTCLINGIYWEQNTPRLLTRQDAQSLLAPGKFS
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS720315-01 48 Well
Rabbit Protein Tyrosine Phosphatase Receptor Type N ELISA Kit
Sign In for Pricing
View Details 
MBS720315-02 96 Well
Rabbit Protein Tyrosine Phosphatase Receptor Type N ELISA Kit
Sign In for Pricing
View Details MBS720315-03 5x 96 Well
Rabbit Protein Tyrosine Phosphatase Receptor Type N ELISA Kit
Sign In for Pricing
View Details 
MBS720315-04 10x 96 Well
Rabbit Protein Tyrosine Phosphatase Receptor Type N ELISA Kit
Sign In for Pricing
View Details 
LV784418 1.0 µg DNA
RPS26P28 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
Sign In for Pricing
View Details