Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFC Peptide - C-terminal region

BPIFC Peptide - C-terminal region

Product Specifications

Product Name Alternative

BPIL2

UniProt

Q8NFQ6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BPIFC Rabbit Polyclonal Antibody (orb589526) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_777592.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FVNSDIEVLEGFLLISTDLKYETSSKQQPSFHVWEGLNLISRQWRGKSAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DDX41 Antibody
NBP1-89297-25ul 25 µL

Rabbit Polyclonal DDX41 Antibody

Sign In for Pricing
View Details
HSP90AB1, CT (HSP90AB1, HSP90B, HSPC2, HSPCB, Heat shock protein HSP 90-beta, Heat shock 84kD) (PE) discontinued
036794-PE 200 µL

HSP90AB1, CT (HSP90AB1, HSP90B, HSPC2, HSPCB, Heat shock protein HSP 90-beta, Heat shock 84kD) (PE) discontinued

Sign In for Pricing
View Details
SLC8A1 Protein Vector (Mouse) (pPM-C-HA)
PV231400 500 ng

SLC8A1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
CD1b (A1 domain, CD1A, Cortical thymocyte antigen CD1A, hTa1 thymocyte antigen, Ly38, T cell surface glycoprotein CD1a, T6/Leu6) (Biotin)
168672-AF-Biotin 100 µL

CD1b (A1 domain, CD1A, Cortical thymocyte antigen CD1A, hTa1 thymocyte antigen, Ly38, T cell surface glycoprotein CD1a, T6/Leu6) (Biotin)

Sign In for Pricing
View Details
Factor XIII antibody (HRP)
MBS832603-01 0.2 mg

Factor XIII antibody (HRP)

Sign In for Pricing
View Details
Factor XIII antibody (HRP)
MBS832603-02 5x 0.2 mg

Factor XIII antibody (HRP)

Sign In for Pricing
View Details