Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MUC13 Peptide - C-terminal region

MUC13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DRCC1, MUC-13

UniProt

Q9H3R2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MUC13 Rabbit Polyclonal Antibody (orb589864) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_149038.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DFQNLKLRSTGFTNLGAEGSVFPKVRITASRDSQMQNPYSRHSSMPRPDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INO80E 3'UTR Luciferase Stable Cell Line
TU011170 1.0 mL

INO80E 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human Death domain-containing protein CRADD, CRADD ELISA Kit
MBS9334638-01 48 Well

Human Death domain-containing protein CRADD, CRADD ELISA Kit

Sign In for Pricing
View Details
Human Death domain-containing protein CRADD, CRADD ELISA Kit
MBS9334638-02 96 Well

Human Death domain-containing protein CRADD, CRADD ELISA Kit

Sign In for Pricing
View Details
Human Death domain-containing protein CRADD, CRADD ELISA Kit
MBS9334638-03 5x 96 Well

Human Death domain-containing protein CRADD, CRADD ELISA Kit

Sign In for Pricing
View Details
Human Death domain-containing protein CRADD, CRADD ELISA Kit
MBS9334638-04 10x 96 Well

Human Death domain-containing protein CRADD, CRADD ELISA Kit

Sign In for Pricing
View Details
Calcifediol monohydrate
orb1300774-01 1 mg

Calcifediol monohydrate

Sign In for Pricing
View Details