Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCTP Peptide - middle region

PCTP Peptide - middle region

Product Specifications

Product Name Alternative

PC-TP, STARD2

UniProt

Q9UKL6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCTP Rabbit Polyclonal Antibody (orb589879) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001095872.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GluR2 Antibody
MBS9613689-01 0.1 mL

GluR2 Antibody

Sign In for Pricing
View Details
GluR2 Antibody
MBS9613689-02 0.2 mL

GluR2 Antibody

Sign In for Pricing
View Details
GluR2 Antibody
MBS9613689-03 5x 0.2 mL

GluR2 Antibody

Sign In for Pricing
View Details
Neurofascin Rabbit Polyclonal Antibody (APC-Cy7)
orb2558950 100 µL

Neurofascin Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Fish Interferon gamma, IFNG ELISA KIT
EA0014FI 96 Well

Fish Interferon gamma, IFNG ELISA KIT

Sign In for Pricing
View Details
UBE2G2 Antibody, Biotin conjugated
CSB-PA025454LD01HU-01 50 µg

UBE2G2 Antibody, Biotin conjugated

Sign In for Pricing
View Details