PCTP Peptide - middle region
PCTP Peptide - middle region
Product Specifications
Product Name Alternative
PC-TP, STARD2
UniProt
Q9UKL6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PCTP Rabbit Polyclonal Antibody (orb589879) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001095872.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6213704-01 0.1 mL
ROBO3 (Roundabout Homolog 3, Roundabout-like Protein 3, HGPS, HGPPS, RBIG1, RIG1) (MaxLight 550)
Sign In for Pricing
View Details MBS6213704-02 5x 0.1 mL
ROBO3 (Roundabout Homolog 3, Roundabout-like Protein 3, HGPS, HGPPS, RBIG1, RIG1) (MaxLight 550)
Sign In for Pricing
View Details 