Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBBP5 Peptide - C-terminal region

RBBP5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RBQ3, SWD1

UniProt

Q15291

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBBP5 Rabbit Polyclonal Antibody (orb588158) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001180201

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVPNDEVHPLLGVKGDGKSKKKQAGRPKGSKGKEKDSPFKPKLYKGDRGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ATF7IP Antibody, Rabbit Polyclonal
MBS8108802-01 0.1 mL

Anti-ATF7IP Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-ATF7IP Antibody, Rabbit Polyclonal
MBS8108802-02 5x 0.1 mL

Anti-ATF7IP Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Rabbit Anti-Human COL18A1 Polyclonal Antibody
PA90821HU-01 50 µg

Rabbit Anti-Human COL18A1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human COL18A1 Polyclonal Antibody
PA90821HU-02 100 µg

Rabbit Anti-Human COL18A1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human COL18A1 Polyclonal Antibody
PA90821HU-03 500 µg

Rabbit Anti-Human COL18A1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human COL18A1 Polyclonal Antibody
PA90821HU-04 1 mg

Rabbit Anti-Human COL18A1 Polyclonal Antibody

Sign In for Pricing
View Details