Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBBP5 Peptide - C-terminal region

RBBP5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RBQ3, SWD1

UniProt

Q15291

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBBP5 Rabbit Polyclonal Antibody (orb588158) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001180201

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVPNDEVHPLLGVKGDGKSKKKQAGRPKGSKGKEKDSPFKPKLYKGDRGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TNF-alpha Antibody (6N2E12) [DyLight 488]
NBP2-27351G 0.1 mL

Mouse Monoclonal TNF-alpha Antibody (6N2E12) [DyLight 488]

Sign In for Pricing
View Details
Rabbit Anti AGT Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8422288-01 0.001 mL

Rabbit Anti AGT Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti AGT Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8422288-02 5x 0.001 mL

Rabbit Anti AGT Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)

Sign In for Pricing
View Details
Mouse Cell cycle progression protein 1 (CCPG1) ELISA Kit
GTR10345000 96 Well

Mouse Cell cycle progression protein 1 (CCPG1) ELISA Kit

Sign In for Pricing
View Details
Human I-PTH (Intact PaRathormone) Quick ELISA Kit
orb2567967-01 48 Tests

Human I-PTH (Intact PaRathormone) Quick ELISA Kit

Sign In for Pricing
View Details
Human I-PTH (Intact PaRathormone) Quick ELISA Kit
orb2567967-02 96 Tests

Human I-PTH (Intact PaRathormone) Quick ELISA Kit

Sign In for Pricing
View Details