Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGA6 Peptide - N-terminal region

ITGA6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD49f, VLA-6, ITGA6B

UniProt

P23229

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITGA6 Rabbit Polyclonal Antibody (orb589566) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000201.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDQWMGVTVQSQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OVOL1 Rabbit Polyclonal Antibody
TA355790 100 µL

OVOL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MPPED1 Antibody
C50953-01 40 µL

MPPED1 Antibody

Sign In for Pricing
View Details
MPPED1 Antibody
C50953-02 100 µL

MPPED1 Antibody

Sign In for Pricing
View Details
MPPED1 Antibody
C50953-03 200 µL

MPPED1 Antibody

Sign In for Pricing
View Details
Sephacryl S-200 HR
Se-476C 150 mL

Sephacryl S-200 HR

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp. jejuni serotype O:23/36 Putative protein-disulfide oxidoreductase (CJJ81176_0881)
MBS7037004-01 0.02 mg

Recombinant Campylobacter jejuni subsp. jejuni serotype O:23/36 Putative protein-disulfide oxidoreductase (CJJ81176_0881)

Sign In for Pricing
View Details