Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGA6 Peptide - N-terminal region

ITGA6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD49f, VLA-6, ITGA6B

UniProt

P23229

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITGA6 Rabbit Polyclonal Antibody (orb589566) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000201.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDQWMGVTVQSQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RHOQ sgRNA gene knockout kit - Lentiviral human RHOQ sgRNA gene knockout kit (100)
GTR15368908 1 Vial

Lentiviral human RHOQ sgRNA gene knockout kit - Lentiviral human RHOQ sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Hemicholinium-3
sc-252873A 500 mg

Hemicholinium-3

Sign In for Pricing
View Details
PDX1 Polyclonal Antibody
MBS2522899-01 0.02 mL

PDX1 Polyclonal Antibody

Sign In for Pricing
View Details
PDX1 Polyclonal Antibody
MBS2522899-02 0.06 mL

PDX1 Polyclonal Antibody

Sign In for Pricing
View Details
PDX1 Polyclonal Antibody
MBS2522899-03 0.12 mL

PDX1 Polyclonal Antibody

Sign In for Pricing
View Details
PDX1 Polyclonal Antibody
MBS2522899-04 0.2 mL

PDX1 Polyclonal Antibody

Sign In for Pricing
View Details