Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHPS Peptide - middle region

DHPS Peptide - middle region

Product Specifications

Product Name Alternative

DS, DHS, MIG13

UniProt

P49366

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DHPS Rabbit Polyclonal Antibody (orb589610) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001193903.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRV

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human MCP-1
GWB-BIG67D 500 µg

Anti-Human MCP-1

Sign In for Pricing
View Details
1-[2- (2-Chlorophenoxy) ethyl]-1H-indole-3-carboxylic acid
SKB25506-01 50 mg

1-[2- (2-Chlorophenoxy) ethyl]-1H-indole-3-carboxylic acid

Sign In for Pricing
View Details
1-[2- (2-Chlorophenoxy) ethyl]-1H-indole-3-carboxylic acid
SKB25506-02 0.5 g

1-[2- (2-Chlorophenoxy) ethyl]-1H-indole-3-carboxylic acid

Sign In for Pricing
View Details
Pdia4 (NM_009787) Mouse Tagged ORF Clone
MR220604 10 µg

Pdia4 (NM_009787) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Anti-NMDA NR2B Subunit (Tyr1336) antibody
STJ120166 100 µl

Anti-NMDA NR2B Subunit (Tyr1336) antibody

Sign In for Pricing
View Details
Human 27-Hydroxycholesterol (27-OHC) ELISA Kit
201-12-6008 96 Tests

Human 27-Hydroxycholesterol (27-OHC) ELISA Kit

Sign In for Pricing
View Details