Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHPS Peptide - middle region

DHPS Peptide - middle region

Product Specifications

Product Name Alternative

DS, DHS, MIG13

UniProt

P49366

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DHPS Rabbit Polyclonal Antibody (orb589610) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001193903.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRV

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAE-1
ABC-TC0066 1 Vial

BAE-1

Sign In for Pricing
View Details
Montelukast dicarboxylic acid
NIA38027-01 5 mg

Montelukast dicarboxylic acid

Sign In for Pricing
View Details
Montelukast dicarboxylic acid
NIA38027-02 10 mg

Montelukast dicarboxylic acid

Sign In for Pricing
View Details
Montelukast dicarboxylic acid
NIA38027-03 25 mg

Montelukast dicarboxylic acid

Sign In for Pricing
View Details
Montelukast dicarboxylic acid
NIA38027-04 50 mg

Montelukast dicarboxylic acid

Sign In for Pricing
View Details
VTI1B, 1-208aa, Human, His tag, E Coli
MBS204600-01 0.004 mg

VTI1B, 1-208aa, Human, His tag, E Coli

Sign In for Pricing
View Details