KSR1 Peptide - middle region
KSR1 Peptide - middle region
Product Specifications
Product Name Alternative
KSR, RSU2
UniProt
Q8IVT5
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KSR1 Rabbit Polyclonal Antibody (orb589820) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_055053.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SPAPFPTSSNPSSATTPPNPSPGQRDSRFNFPAAYFIHHRQQFIFPVPSA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-CL-H0222-01 24 Tests
Human ADAMTS4 (ADAM with Thrombospondin Type 1 Motif 4) CLIA Kit
Sign In for Pricing
View Details E-CL-H0222-02 48 Tests
Human ADAMTS4 (ADAM with Thrombospondin Type 1 Motif 4) CLIA Kit
Sign In for Pricing
View Details E-CL-H0222-03 96 Tests
Human ADAMTS4 (ADAM with Thrombospondin Type 1 Motif 4) CLIA Kit
Sign In for Pricing
View Details ![Histone H4 (acetyl K16) Recombinant Rabbit Monoclonal Antibody [JB21-44]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81d09/imageurl/et7107-89.webp)
ET7107-89 100 µL
Histone H4 (acetyl K16) Recombinant Rabbit Monoclonal Antibody [JB21-44]
Sign In for Pricing
View Details 
BNUM2250-50 1x 50 µL
Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), 1mg/mL
Sign In for Pricing
View Details