Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KSR1 Peptide - middle region

KSR1 Peptide - middle region

Product Specifications

Product Name Alternative

KSR, RSU2

UniProt

Q8IVT5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KSR1 Rabbit Polyclonal Antibody (orb589820) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055053.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPAPFPTSSNPSSATTPPNPSPGQRDSRFNFPAAYFIHHRQQFIFPVPSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prostatic Acid Phosphatase (ACPP) (C-term) Rabbit Polyclonal Antibody
AP14250PU-N 400 µL

Prostatic Acid Phosphatase (ACPP) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (PAX8/1492), CF594 conjugate, 0.1mg/mL
BNC941492-100 1x 100 µL

PAX8 (Renal Cell Marker) (PAX8/1492), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human EAPP activation kit by CRISPRa
GA111008 1 Kit

Human EAPP activation kit by CRISPRa

Sign In for Pricing
View Details
Pyrazole-1-propionitrile (>90%)
TRC-I707290-500MG 500 mg

Pyrazole-1-propionitrile (>90%)

Sign In for Pricing
View Details
BAG1 Human Knockdown Lysate
LY300065 100 µg

BAG1 Human Knockdown Lysate

Sign In for Pricing
View Details
FBXO31 Rabbit Polyclonal Antibody
TA376160 100 µL

FBXO31 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details