Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIP1 Peptide - N-terminal region

HIP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SHON, HIP-I, ILWEQ, SHONbeta, SHONgamma

UniProt

O00291

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HIP1 Rabbit Polyclonal Antibody (orb589759) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001230127.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KMEYHTKNPRFPGNLQMSDRQLDEAGESDVNNFFQLTVEMFDYLECELNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFP38 (ZSCAN21) (NM_145914) Human Recombinant Protein
TP308411L 1 mg

ZFP38 (ZSCAN21) (NM_145914) Human Recombinant Protein

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), CF594 conjugate, 0.1mg/mL
BNC942807-500 1x 500 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human c-KIT/CD117 Protein (Fc Tag)
PKSH030941 50 µg

Recombinant Human c-KIT/CD117 Protein (Fc Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS621760 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Supervillin (SVIL) Human Gene Knockout Kit (CRISPR)
KN416323 1 Kit

Supervillin (SVIL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APOBEC3A (NM_145699) Human Recombinant Protein
TP320995M 100 µg

APOBEC3A (NM_145699) Human Recombinant Protein

Sign In for Pricing
View Details