Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIP1 Peptide - N-terminal region

HIP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SHON, HIP-I, ILWEQ, SHONbeta, SHONgamma

UniProt

O00291

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HIP1 Rabbit Polyclonal Antibody (orb589759) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001230127.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KMEYHTKNPRFPGNLQMSDRQLDEAGESDVNNFFQLTVEMFDYLECELNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRELD2 Polyclonal Antibody
E-AB-14894-01 20 µL

CRELD2 Polyclonal Antibody

Sign In for Pricing
View Details
CRELD2 Polyclonal Antibody
E-AB-14894-02 60 µL

CRELD2 Polyclonal Antibody

Sign In for Pricing
View Details
CRELD2 Polyclonal Antibody
E-AB-14894-03 120 µL

CRELD2 Polyclonal Antibody

Sign In for Pricing
View Details
CRELD2 Polyclonal Antibody
E-AB-14894-04 200 µL

CRELD2 Polyclonal Antibody

Sign In for Pricing
View Details
FG 2216
TRC-F329000-50MG 50 mg

FG 2216

Sign In for Pricing
View Details
ATP1B3 (C-term) Rabbit Polyclonal Antibody
AP50295PU-N 400 µL

ATP1B3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details