Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NHEJ1 Peptide - middle region

NHEJ1 Peptide - middle region

Product Specifications

Product Name Alternative

XLF

UniProt

Q9H9Q4

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NHEJ1 Rabbit Polyclonal Antibody (orb589804) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_079058.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tp63 Antibody (HRP)
orb517357-01 50 µg

Tp63 Antibody (HRP)

Sign In for Pricing
View Details
Tp63 Antibody (HRP)
orb517357-02 100 µg

Tp63 Antibody (HRP)

Sign In for Pricing
View Details
Fragilis Rabbit Polyclonal Antibody (PE-Cy5)
orb905674 100 µL

Fragilis Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Tbx10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4093808 1.0 µg DNA

Tbx10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
1-Decanoin-2-Myristin
MBS394388-01 25 mg

1-Decanoin-2-Myristin

Sign In for Pricing
View Details
1-Decanoin-2-Myristin
MBS394388-02 5x 25 mg

1-Decanoin-2-Myristin

Sign In for Pricing
View Details