BPI Peptide - middle region
BPI Peptide - middle region
Product Specifications
Product Name Alternative
RBPI, BPIFD1
UniProt
P17213
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BPI Rabbit Polyclonal Antibody (orb589583) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001716.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AGINYGLVAPPATTAETLDVQMKGEFYSENHHNPPPFAPPVMEFPAAHDR
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10414183 96 Well
Mouse Activating signal cointegor 1 complex subunit 2 (ASCC2) ELISA kit
Sign In for Pricing
View Details 
GTR15341529 1 Vial
Lentiviral human TBCEL shRNA (UAS) - Lentiviral human TBCEL shRNA (UAS) (100)
Sign In for Pricing
View Details 
GTR10379416 96 Well
Sheep Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 4 ELISA kit
Sign In for Pricing
View Details