Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYBRD1 Peptide - C-terminal region

CYBRD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DCYTB, FRRS3, CYB561A2

UniProt

Q53TN4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYBRD1 Rabbit Polyclonal Antibody (orb589919) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001120855.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PNGGTEQGARGSMPAYSGNNMDKSDSELNSEVAARKRNLALDEAGQRSTM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5JP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV757807 1.0 µg DNA

ATP5JP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
EPZ020411 hydrochloride 50mg
A21802-50 50 mg

EPZ020411 hydrochloride 50mg

Sign In for Pricing
View Details
Ankyrin B (3G7) : m-IgGλ BP-HRP Bundle
sc-521089 1 Kit

Ankyrin B (3G7) : m-IgGλ BP-HRP Bundle

Sign In for Pricing
View Details
APPBP1 Blocking Peptide
MBS9621531-01 1 mg

APPBP1 Blocking Peptide

Sign In for Pricing
View Details
APPBP1 Blocking Peptide
MBS9621531-02 5x 1 mg

APPBP1 Blocking Peptide

Sign In for Pricing
View Details
BCL-10 (BL10/411), CF488A conjugate, 0.1mg/mL
BNC880411-100 1x 100 µL

BCL-10 (BL10/411), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details