Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYBRD1 Peptide - C-terminal region

CYBRD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DCYTB, FRRS3, CYB561A2

UniProt

Q53TN4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYBRD1 Rabbit Polyclonal Antibody (orb589919) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001120855.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PNGGTEQGARGSMPAYSGNNMDKSDSELNSEVAARKRNLALDEAGQRSTM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1090 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7160303 1.0 µg DNA

Olr1090 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
LOC690369 3'UTR Luciferase Stable Cell Line
TU212104 1.0 mL

LOC690369 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
RPS24P2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2045306 1.0 µg DNA

RPS24P2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
KIR2DL4 Rabbit Polyclonal Antibody (FITC)
orb8660 100 µL

KIR2DL4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
HSF1 (phospho Thr142) Rabbit Polyclonal Antibody
E28PP1026 100 µL

HSF1 (phospho Thr142) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Slc1a6 Mouse shRNA Plasmid (Locus ID 20513)
TL502051 1 Kit

Slc1a6 Mouse shRNA Plasmid (Locus ID 20513)

Sign In for Pricing
View Details