Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELF1 Peptide - middle region

ELF1 Peptide - middle region

Product Specifications

UniProt

P32519

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELF1 Rabbit Polyclonal Antibody (orb589859) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001138825.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPEQPKRKKGRKTKPPRPDSPATTPNISVKKKNKDGKGNTIYLWEFLLAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAI-1 (Q732) polyclonal antibody
orb643748-01 25 µL

BAI-1 (Q732) polyclonal antibody

Sign In for Pricing
View Details
BAI-1 (Q732) polyclonal antibody
orb643748-02 50 μL

BAI-1 (Q732) polyclonal antibody

Sign In for Pricing
View Details
BAI-1 (Q732) polyclonal antibody
orb643748-03 100 µL

BAI-1 (Q732) polyclonal antibody

Sign In for Pricing
View Details
BAI-1 (Q732) polyclonal antibody
orb643748-04 200 µL

BAI-1 (Q732) polyclonal antibody

Sign In for Pricing
View Details
DHFR Polyclonal Antibody
MBS2562741-01 0.02 mL

DHFR Polyclonal Antibody

Sign In for Pricing
View Details
DHFR Polyclonal Antibody
MBS2562741-02 0.06 mL

DHFR Polyclonal Antibody

Sign In for Pricing
View Details