Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELF1 Peptide - middle region

ELF1 Peptide - middle region

Product Specifications

UniProt

P32519

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELF1 Rabbit Polyclonal Antibody (orb589859) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001138825.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPEQPKRKKGRKTKPPRPDSPATTPNISVKKKNKDGKGNTIYLWEFLLAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cerulenin
C18496-5mg 5 mg

Cerulenin

Sign In for Pricing
View Details
D-Luciferin
S7763-10mM/1mL 10 mM/1mL

D-Luciferin

Sign In for Pricing
View Details
Horse Uncharacterized Protein C2orf16 (C2ORF16) ELISA Kit
MBS9398962-01 48 Well

Horse Uncharacterized Protein C2orf16 (C2ORF16) ELISA Kit

Sign In for Pricing
View Details
Horse Uncharacterized Protein C2orf16 (C2ORF16) ELISA Kit
MBS9398962-02 96 Well

Horse Uncharacterized Protein C2orf16 (C2ORF16) ELISA Kit

Sign In for Pricing
View Details
Horse Uncharacterized Protein C2orf16 (C2ORF16) ELISA Kit
MBS9398962-03 5x 96 Well

Horse Uncharacterized Protein C2orf16 (C2ORF16) ELISA Kit

Sign In for Pricing
View Details
Horse Uncharacterized Protein C2orf16 (C2ORF16) ELISA Kit
MBS9398962-04 10x 96 Well

Horse Uncharacterized Protein C2orf16 (C2ORF16) ELISA Kit

Sign In for Pricing
View Details