MUC4 Peptide - middle region
MUC4 Peptide - middle region
Product Specifications
Product Name Alternative
ASGP, MUC-4, HSA276359
UniProt
Q99102
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MUC4 Rabbit Polyclonal Antibody (orb589617) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_004523.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VWNNNPEDDFRMPNGSTIPPGSPEEMLFHFGMTWQINGTGLLGKRNDQLP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ICH1205-50mg 50 mg
Anti-Mouse CD317 (927) In Vivo Antibody - Low Endotoxin
Sign In for Pricing
View Details ![CD45 / LCA Mouse Monoclonal Antibody [Clone ID: LT40]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fc1c1/imageurl/am08122rp-n.webp)
AM08122RP-N 100 µg
CD45 / LCA Mouse Monoclonal Antibody [Clone ID: LT40]
Sign In for Pricing
View Details ![NCF4 Mouse Monoclonal Antibody [Clone ID: OTI3E8]](https://cdn.genprice.uk/products/937/68dd18ba061270361e90852d/imageurl/cf809222.webp)