MUC4 Peptide - middle region
MUC4 Peptide - middle region
Product Specifications
Product Name Alternative
ASGP, MUC-4, HSA276359
UniProt
Q99102
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MUC4 Rabbit Polyclonal Antibody (orb589617) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_004523.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VWNNNPEDDFRMPNGSTIPPGSPEEMLFHFGMTWQINGTGLLGKRNDQLP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-A161210-25MG 25 mg
Alpha-Acetamino-Alpha-carboxy-(3-indole)-butyric Acid
Sign In for Pricing
View Details 
BNC043177-100 1x 100 µL
TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Factor H Recombinant Rabbit Monoclonal Antibody [JA52-13]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea81204/imageurl/et1704-83.webp)
ET1704-83 100 µL
Factor H Recombinant Rabbit Monoclonal Antibody [JA52-13]
Sign In for Pricing
View Details 