Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGA9 Peptide - C-terminal region

ITGA9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RLC, ITGA4L, ALPHA-RLC

UniProt

Q13797

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITGA9 Rabbit Polyclonal Antibody (orb589964) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002198.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKNRKENEDSWDWVQKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Butene-3,4-diol
TRC-B690165-1G 1 g

1-Butene-3,4-diol

Sign In for Pricing
View Details
Human TACSTD2/TROP2, C-His Tag (ECD)
HA210737-01 20 µg

Human TACSTD2/TROP2, C-His Tag (ECD)

Sign In for Pricing
View Details
Human TACSTD2/TROP2, C-His Tag (ECD)
HA210737-02 50 µg

Human TACSTD2/TROP2, C-His Tag (ECD)

Sign In for Pricing
View Details
Human TACSTD2/TROP2, C-His Tag (ECD)
HA210737-03 100 µg

Human TACSTD2/TROP2, C-His Tag (ECD)

Sign In for Pricing
View Details
GARS Mouse Monoclonal Antibody [Clone ID: AT4E10]
AM50342PU-S 50 µL

GARS Mouse Monoclonal Antibody [Clone ID: AT4E10]

Sign In for Pricing
View Details
L-Glutamic Anhydride Hydrochloride
TRC-G597085-1G 1 g

L-Glutamic Anhydride Hydrochloride

Sign In for Pricing
View Details