Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGA9 Peptide - C-terminal region

ITGA9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RLC, ITGA4L, ALPHA-RLC

UniProt

Q13797

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITGA9 Rabbit Polyclonal Antibody (orb589964) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002198.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKNRKENEDSWDWVQKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF405S conjugate, 0.1mg/mL
BNC041274-500 1x 500 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Processor BHTP-303
BHTP-303 1 Unit

Tissue Processor BHTP-303

Sign In for Pricing
View Details
2-Cyano-3,3-diphenylacrylic Acid
TRC-C979373-1G 1 g

2-Cyano-3,3-diphenylacrylic Acid

Sign In for Pricing
View Details
Recombinant Human SULT1E1/ST1E1 Protein (His Tag)
PKSH031173 50 µg

Recombinant Human SULT1E1/ST1E1 Protein (His Tag)

Sign In for Pricing
View Details
n-Butyltriphenylphosphonium Bromide
TRC-B693805-50G 50 g

n-Butyltriphenylphosphonium Bromide

Sign In for Pricing
View Details
SCAND1 Human Gene Knockout Kit (CRISPR)
KN400079 1 Kit

SCAND1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details