Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS30 Peptide - middle region

MRPS30 Peptide - middle region

Product Specifications

Product Name Alternative

PAP, PDCD9, S30mt, MRP-S30

UniProt

Q9NP92

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057724.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLSGLPPPPAEPEPEPEPEPEPALDLAALRAVACDCLLQEHFYLRRRRRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Pancreas
CP565666 150 µg

Tissue Protein Lysate, Pancreas

Sign In for Pricing
View Details
LRP1B Human Gene Knockout Kit (CRISPR)
KN424195 1 Kit

LRP1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SnoN (SKIL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H2]
TA800165AM 100 µL

SnoN (SKIL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H2]

Sign In for Pricing
View Details
Perthan
TRC-P698215-50MG 50 mg

Perthan

Sign In for Pricing
View Details
QK1 (QKI) (NM_206855) Human Recombinant Protein
TP315788L 1 mg

QK1 (QKI) (NM_206855) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse TBG (Thyroxine Binding Globulin) CLIA Kit
E-CL-M0647-01 24 Tests

Mouse TBG (Thyroxine Binding Globulin) CLIA Kit

Sign In for Pricing
View Details