Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS30 Peptide - middle region

MRPS30 Peptide - middle region

Product Specifications

Product Name Alternative

PAP, PDCD9, S30mt, MRP-S30

UniProt

Q9NP92

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057724.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLSGLPPPPAEPEPEPEPEPEPALDLAALRAVACDCLLQEHFYLRRRRRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calbindin 1 (CALB1) (CALB1/2364), 0.2mg/mL
BNUB2364-100 1x 100 µL

Calbindin 1 (CALB1) (CALB1/2364), 0.2mg/mL

Sign In for Pricing
View Details
TNFRSF1B (N-term) Rabbit Polyclonal Antibody
AP23408PU-N 100 µg

TNFRSF1B (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(E)-5-(3-Aminophenyl)-2-penten-4-ynoic Acid Ethyl Ester Trifluoroacetic Acid Salt
TRC-A625800-25MG 25 mg

(E)-5-(3-Aminophenyl)-2-penten-4-ynoic Acid Ethyl Ester Trifluoroacetic Acid Salt

Sign In for Pricing
View Details
ZNF416 Human Gene Knockout Kit (CRISPR)
KN401632 1 Kit

ZNF416 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human IL18RAP/IL1R7 Protein (His Tag)
PKSH031797 100 µg

Recombinant Human IL18RAP/IL1R7 Protein (His Tag)

Sign In for Pricing
View Details
BDH1 Human Gene Knockout Kit (CRISPR)
KN400873 1 Kit

BDH1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details